PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P06630_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 566aa    MW: 63044.4 Da    PI: 6.7616
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P06630_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.8e-094084451954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+++e+  LA+++gL+ +qV++WF N R +
  GSMUA_Achr4P06630_001 408 FEHflHPYPKESEKLILARQTGLSRSQVTNWFINARVR 445
                            664459******************************88 PP

2BELL107.39.4e-35273342372
                   BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            q+lq+k + Ll +l+e+d+rYkqy++q+q+++s F+a+ag+g+akpYt+lA ++iS hFrcL+dai +qi
  GSMUA_Achr4P06630_001 273 QDLQNKVSNLLGMLDEIDRRYKQYYHQMQIIVSYFDAIAGCGTAKPYTALAFQTISCHFRCLRDAINGQI 342
                            899*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.1E-47213340IPR006563POX domain
PfamPF075266.3E-42219338IPR006563POX domain
PROSITE profilePS5007112.179386449IPR001356Homeobox domain
SMARTSM003895.5E-9389453IPR001356Homeobox domain
CDDcd000861.96E-11389450No hitNo description
SuperFamilySSF466892.61E-17390456IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-27392455IPR009057Homeodomain-like
PfamPF059201.9E-17406445IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MSTFCSISSD QSGTSPDLGL RDPGHASYSE SPGPGNMMYL SFLNSGPYRD AVAGGAQTHQ  60
NHIELPVATT IISPDLTTGN SVMVPSCLGN HANNAWKNGR SEMLFMQTDR GSILGTDDLL  120
HAADPQTSVQ TQLSIIHGLS LSLQHSNVTL QNQGLSLSLS TQMPVPSIQY PSTTSNIPFF  180
DSNQSTSGNV GSFREEHFQT RNFHDNASPN GLTSLTRLIP NSKYLRAAQE LLDEVVNVRK  240
ALKQKTDKSQ RLISNPQEAT VNWSSGLSPL VKQDLQNKVS NLLGMLDEID RRYKQYYHQM  300
QIIVSYFDAI AGCGTAKPYT ALAFQTISCH FRCLRDAING QIQATRKNLG EADNSSSKSG  360
LLSRLRNIDQ KLRQQSALQQ FGSMQQHTWR PQRGLPESSV SILRAWLFEH FLHPYPKESE  420
KLILARQTGL SRSQVTNWFI NARVRLWKPM IEDMYKEEIG DTEIDSNSSE NPPKLKEDFQ  480
SSEDHEDLQM YGTGRYQTGQ IIDSSRPITM NVAEAAATFQ HEASAQDSYK YLKANEQRPI  540
GEDSSFLQDV IGHPDGKGRF LAYQMA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16395452562Homeobox protein Meis2
3k2a_B4e-16395452562Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395555.10.0PREDICTED: BEL1-like homeodomain protein 6
TrEMBLM0SLN00.0M0SLN0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P06630_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-114BEL1-like homeodomain 7